(data stored in ACNUC7421 zone)

EMBL: CP000270.PE564

CP000270.PE564       Location/Qualifiers
FT   CDS             632322..632798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3895"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3895"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29102"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Y7"
FT                   /protein_id="ABE29102.1"
FT                   /translation="MPLQEHSWYDHVRLKRVFVTDGTRHQVVLVDVRKLLVCADRDNTD
FT                   YVLKPVAEWHSGKVRGIREFLDPDNTRVPQMPYVTISTRRAPGLLGWVGLEREGVVAFR
FT                   NGQHRARYLAEAGARWFPVEVHEREALLLRELCGAADDARTVVRATSLNSGGGV"
     MPLQEHSWYD HVRLKRVFVT DGTRHQVVLV DVRKLLVCAD RDNTDYVLKP VAEWHSGKVR        60
     GIREFLDPDN TRVPQMPYVT ISTRRAPGLL GWVGLEREGV VAFRNGQHRA RYLAEAGARW       120
     FPVEVHEREA LLLRELCGAA DDARTVVRAT SLNSGGGV                               158
//

If you have problems or comments...

PBIL Back to PBIL home page