(data stored in ACNUC7421 zone)

EMBL: CP000270.PE567

CP000270.PE567       Location/Qualifiers
FT   CDS             636067..637749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3892"
FT                   /product="Aspartate/alanine exchanger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3892"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29105"
FT                   /db_xref="GOA:Q144Y4"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR022457"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Y4"
FT                   /protein_id="ABE29105.1"
FT                   /translation="MDWLHHIFQKSPEIALFLSLAAGYFIGQINFGKFQLGGVGGSLLA
FT                   AVVISQAGVTIDNGVKSVMFAVFIYAVGYDSGPGFFNSLNRKTLREIAMAVFLAVTALI
FT                   TVVVCAKLFHLNKGLAAGLAGGALTQSAIIGTAGDAIARLGLPADQVKSLQSDVAIAYA
FT                   VTYVFGSLGAIIVCVNILPKFMGQGLREASVEVERELTAGAAAAGPGQLSALPEMVGRA
FT                   YKIDVSAGKTVKAVETLHQDLLTIERIKRDGQPLDPAPGLILKPGDVVLVVGRREAVVE
FT                   FGAAGGEVATVEDVGAVMQTREAVFTRKGMNHTTIAAARAVVDRDMRHGVYIQSISRAG
FT                   QPLPVLPETKLEHGDVITFYGSPKDTKRAAEAAGYELPYSNKTDFIYMGVGIVLGLLIG
FT                   LIVVNVAGIPLTLGSGGGCLLAGLLFGWMRGKHPMYGAMPSAASQLLKDFGLAAFVAVV
FT                   GLNSGLQAVVTVKQSGMTIFLLGVFVTLFPLLLTMLFGRYVLKYNNSAILAGALSGSRS
FT                   ANPAFGGVLDKAESAVPTVPFAITYAIANVALTLLGPLVVGLV"
     MDWLHHIFQK SPEIALFLSL AAGYFIGQIN FGKFQLGGVG GSLLAAVVIS QAGVTIDNGV        60
     KSVMFAVFIY AVGYDSGPGF FNSLNRKTLR EIAMAVFLAV TALITVVVCA KLFHLNKGLA       120
     AGLAGGALTQ SAIIGTAGDA IARLGLPADQ VKSLQSDVAI AYAVTYVFGS LGAIIVCVNI       180
     LPKFMGQGLR EASVEVEREL TAGAAAAGPG QLSALPEMVG RAYKIDVSAG KTVKAVETLH       240
     QDLLTIERIK RDGQPLDPAP GLILKPGDVV LVVGRREAVV EFGAAGGEVA TVEDVGAVMQ       300
     TREAVFTRKG MNHTTIAAAR AVVDRDMRHG VYIQSISRAG QPLPVLPETK LEHGDVITFY       360
     GSPKDTKRAA EAAGYELPYS NKTDFIYMGV GIVLGLLIGL IVVNVAGIPL TLGSGGGCLL       420
     AGLLFGWMRG KHPMYGAMPS AASQLLKDFG LAAFVAVVGL NSGLQAVVTV KQSGMTIFLL       480
     GVFVTLFPLL LTMLFGRYVL KYNNSAILAG ALSGSRSANP AFGGVLDKAE SAVPTVPFAI       540
     TYAIANVALT LLGPLVVGLV                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page