(data stored in ACNUC7421 zone)

EMBL: CP000270.PE569

CP000270.PE569       Location/Qualifiers
FT   CDS             complement(640004..640453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3890"
FT                   /product="Putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3890"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29107"
FT                   /db_xref="GOA:Q144Y2"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Y2"
FT                   /protein_id="ABE29107.1"
FT                   /translation="MTYHAVTVTLENIGGIVVVKDKYNSTTQGVTFNATIAGKRQYAVV
FT                   MRGNPRLDNGMVVTAVLRDPENWQTLAGWLNHATGEICGVDSPGQRGAICAFTILFGIV
FT                   FLLRALRPDTGTAFMVVLISVMVAGNAWSMLALRKSLIVYRLLKP"
     MTYHAVTVTL ENIGGIVVVK DKYNSTTQGV TFNATIAGKR QYAVVMRGNP RLDNGMVVTA        60
     VLRDPENWQT LAGWLNHATG EICGVDSPGQ RGAICAFTIL FGIVFLLRAL RPDTGTAFMV       120
     VLISVMVAGN AWSMLALRKS LIVYRLLKP                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page