(data stored in ACNUC7421 zone)

EMBL: CP000270.PE573

CP000270.PE573       Location/Qualifiers
FT   CDS             643596..643979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4507"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29111"
FT                   /db_xref="UniProtKB/TrEMBL:Q144X8"
FT                   /protein_id="ABE29111.1"
FT                   /translation="MNSAGRRDFHMEPILLQNLLNKSTRKGPFQEPYSGPVSARSGLFS
FT                   RHEQQKRFATDCLLSNIKIKNKAKIQMHHKSTAPQTHLDIFLRICPSCDRSYGLCLLTV
FT                   IVFKPSLLHVPADTEHSRVTRHD"
     MNSAGRRDFH MEPILLQNLL NKSTRKGPFQ EPYSGPVSAR SGLFSRHEQQ KRFATDCLLS        60
     NIKIKNKAKI QMHHKSTAPQ THLDIFLRIC PSCDRSYGLC LLTVIVFKPS LLHVPADTEH       120
     SRVTRHD                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page