(data stored in ACNUC7421 zone)

EMBL: CP000270.PE580

CP000270.PE580       Location/Qualifiers
FT   CDS             652627..652980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3880"
FT                   /product="Putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3880"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29118"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q144X1"
FT                   /protein_id="ABE29118.1"
FT                   /translation="MKSVGFLKTLGSVVAMVVACNVYAQASDATATGTTAAPAASAKTV
FT                   KKANSQLGRKVRSALAKAQGIDVSSIAVRARGGAVTLTGSVPDQGQIDAAGQVAKGVAG
FT                   VTSVSNKLTVMQQ"
     MKSVGFLKTL GSVVAMVVAC NVYAQASDAT ATGTTAAPAA SAKTVKKANS QLGRKVRSAL        60
     AKAQGIDVSS IAVRARGGAV TLTGSVPDQG QIDAAGQVAK GVAGVTSVSN KLTVMQQ          117
//

If you have problems or comments...

PBIL Back to PBIL home page