(data stored in ACNUC7421 zone)

EMBL: CP000270.PE582

CP000270.PE582       Location/Qualifiers
FT   CDS             complement(653545..654333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3878"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3878"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29120"
FT                   /db_xref="GOA:Q144W9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W9"
FT                   /protein_id="ABE29120.1"
FT                   /translation="MALPHIDLLYSVSGLFVGFLVGLTGVGGGSLMTPILVLLFNVHPA
FT                   TAVGTDLLYAAATKATGTLVHGLKGSVDWQITLRLAAGSVPAATLTLILLHRYGMDTPG
FT                   AGRLIQIVLGAALLITAVALVFRPQLAALGARKQRTPRQGRTLALTMLTGAVLGVLVSL
FT                   TSVGAGAIGVTVLLLLYPLLPTTRIVGSDIAHAVPLTLLAGAGHWLLGSIDWSMLLSLL
FT                   VGSLPGIAIGSYLSSRAPDALLRNLLAATLTLVGVRLVLA"
     MALPHIDLLY SVSGLFVGFL VGLTGVGGGS LMTPILVLLF NVHPATAVGT DLLYAAATKA        60
     TGTLVHGLKG SVDWQITLRL AAGSVPAATL TLILLHRYGM DTPGAGRLIQ IVLGAALLIT       120
     AVALVFRPQL AALGARKQRT PRQGRTLALT MLTGAVLGVL VSLTSVGAGA IGVTVLLLLY       180
     PLLPTTRIVG SDIAHAVPLT LLAGAGHWLL GSIDWSMLLS LLVGSLPGIA IGSYLSSRAP       240
     DALLRNLLAA TLTLVGVRLV LA                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page