(data stored in ACNUC7421 zone)

EMBL: CP000270.PE584

CP000270.PE584       Location/Qualifiers
FT   CDS             655319..655705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3876"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3876"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29122"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W7"
FT                   /protein_id="ABE29122.1"
FT                   /translation="MSIGSIDSIGSARAVLPASPGVCLVLKGNTISRNYYANQAQPYLK
FT                   SGNGIRLFAEPDFSDILRERIRGREMFSAASQWTECGFISAAMAIMMPATGTLWPKIRD
FT                   VVLRDMPFWMNTRRAAAGLLMRSC"
     MSIGSIDSIG SARAVLPASP GVCLVLKGNT ISRNYYANQA QPYLKSGNGI RLFAEPDFSD        60
     ILRERIRGRE MFSAASQWTE CGFISAAMAI MMPATGTLWP KIRDVVLRDM PFWMNTRRAA       120
     AGLLMRSC                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page