(data stored in ACNUC7421 zone)

EMBL: CP000270.PE590

CP000270.PE590       Location/Qualifiers
FT   CDS             complement(663248..665479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3870"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29128"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W1"
FT                   /protein_id="ABE29128.1"
FT                   /translation="MSRGLRISLVASAAAVILLGLPAVRCAAADAAPQANGASAGNGEF
FT                   TADGRKWTLCAAEYGTCRFSGTRDVLYGTVQQHVVKTFTDSAECNNAVFGDPAPGVEKR
FT                   CAMTQAAQAAAPVANKDTASDTAVRSAALAELKAPPGQGLRCSAPSLQVPTAQNGDLLE
FT                   ADTPSDGTRLFAVARPFALVFTTRPAQSDTLTWQIRDTWNVVRASGRFPVAAGATLSTL
FT                   SCASSVAGYFAVSASLERAHGQLESRGTRPAGIVTFGVLPDTSAALPAVRFPYEDLHRF
FT                   GGQGAAYLAPGQQCCDGDGYRPVYTALGLSWVNDNRNWYMEEPKKPGTFDPATKQLTPF
FT                   FRRGDLMRLIQLDGIPQWASPTGKETHSYAPTSLAQMKDYMARVGAESNRVRMTYFPKQ
FT                   RDNYYQVTWEPDADGGLPWRDTDANFIAMYKAVWEGIHQTDPHAVVMGLTYSSVQGNVT
FT                   WMRKLGPLGIGRYMDGMTIHGYYDIGTTPSHPPERVTDTGNQGTVPGALPAAMRALRHE
FT                   MRLYLKPGAPLFVTETGISYDIGESYGKNYPGADVLYAQAAVTARTHLILLGEGADMTY
FT                   VFYLADMPDAAPGYGIFFELDHPTGAYGPTRISPKPAALAVAAMTRIIDGTVTLGPLKG
FT                   VPKGVYAYAFRRLGGGRIVTALWTHDNDAWSARTGFDASRGVDYRLRVDAPGSTGEVTV
FT                   FDMMGNATTLPYRDGVANVKLSPAPVYVVSGNADVFSNAVMTPEGYVAR"
     MSRGLRISLV ASAAAVILLG LPAVRCAAAD AAPQANGASA GNGEFTADGR KWTLCAAEYG        60
     TCRFSGTRDV LYGTVQQHVV KTFTDSAECN NAVFGDPAPG VEKRCAMTQA AQAAAPVANK       120
     DTASDTAVRS AALAELKAPP GQGLRCSAPS LQVPTAQNGD LLEADTPSDG TRLFAVARPF       180
     ALVFTTRPAQ SDTLTWQIRD TWNVVRASGR FPVAAGATLS TLSCASSVAG YFAVSASLER       240
     AHGQLESRGT RPAGIVTFGV LPDTSAALPA VRFPYEDLHR FGGQGAAYLA PGQQCCDGDG       300
     YRPVYTALGL SWVNDNRNWY MEEPKKPGTF DPATKQLTPF FRRGDLMRLI QLDGIPQWAS       360
     PTGKETHSYA PTSLAQMKDY MARVGAESNR VRMTYFPKQR DNYYQVTWEP DADGGLPWRD       420
     TDANFIAMYK AVWEGIHQTD PHAVVMGLTY SSVQGNVTWM RKLGPLGIGR YMDGMTIHGY       480
     YDIGTTPSHP PERVTDTGNQ GTVPGALPAA MRALRHEMRL YLKPGAPLFV TETGISYDIG       540
     ESYGKNYPGA DVLYAQAAVT ARTHLILLGE GADMTYVFYL ADMPDAAPGY GIFFELDHPT       600
     GAYGPTRISP KPAALAVAAM TRIIDGTVTL GPLKGVPKGV YAYAFRRLGG GRIVTALWTH       660
     DNDAWSARTG FDASRGVDYR LRVDAPGSTG EVTVFDMMGN ATTLPYRDGV ANVKLSPAPV       720
     YVVSGNADVF SNAVMTPEGY VAR                                               743
//

If you have problems or comments...

PBIL Back to PBIL home page