(data stored in ACNUC7421 zone)

EMBL: CP000270.PE596

CP000270.PE596       Location/Qualifiers
FT   CDS             671672..673906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3864"
FT                   /product="Exopolysaccharide export associated tyrosine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3864"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29134"
FT                   /db_xref="GOA:Q144V5"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005700"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:Q144V5"
FT                   /protein_id="ABE29134.1"
FT                   /translation="MAINFENRYTDVSGPDELHLSDYLRTIVRGWRTIAMVTLIALALG
FT                   CAYAFLAPPTYRADVLFHVEDKTANANANGKDSLPPLTGMFDTKPSTAAEIELLKSRLV
FT                   TEETVKKLHLDISAAPRYFPVIGGMIAGLVNGQWGFRLPQFINLSGYAWGDEAITVSQF
FT                   DTSKDMYDTTFTLIAGNDGSYVLRDRNGIAILSGKVGETVETDTADGPITLHVDKLVGP
FT                   AGSRFELSRASTLSTVDRLQKALVVQETTLQSGVIRASLEGGDSALTAAIVNSMAREFV
FT                   RQDVESRSTEAEHMLAFLDQQLPGLRKELDDAEQRYNKFRNTHGTVDLGEESRLLLQQI
FT                   VDNKTKLMDLQQQRAEMSQRFTANHPAVAALDAQIAALQGAAANMNRSVAVMPDTEQTA
FT                   LRLLRDVHVDTELYTNLLNSAQQLRVAKAGQVGSVRVVDFAEAPDDPVRPKRVIAILIA
FT                   LGGGLVLGILLTFFKRAMYGGVERPDELEGMLGVPVFAVVPRSQTQLKLQENVMLRRRG
FT                   LHVLAQQAPEDIAVEGVRNLRTSLQLSLDHAENNVVMITGSRPDSGKSFLSVNLAALVA
FT                   SANKRVLIIDGDMRRGDVHSHFGIGHQPGLSDVLSGGDLNAMIQRDVLPGLDVLAKGTL
FT                   PSHPAELLMSKRFETMLEELKSHYDLVIVDTPPVLAVTDSTLIGKYAGTTLLVVRHGRH
FT                   PLNEVMETAKRLRNGGVALRGVLLTDVPQEGAFLGSGYQGGYYGYDSIAG"
     MAINFENRYT DVSGPDELHL SDYLRTIVRG WRTIAMVTLI ALALGCAYAF LAPPTYRADV        60
     LFHVEDKTAN ANANGKDSLP PLTGMFDTKP STAAEIELLK SRLVTEETVK KLHLDISAAP       120
     RYFPVIGGMI AGLVNGQWGF RLPQFINLSG YAWGDEAITV SQFDTSKDMY DTTFTLIAGN       180
     DGSYVLRDRN GIAILSGKVG ETVETDTADG PITLHVDKLV GPAGSRFELS RASTLSTVDR       240
     LQKALVVQET TLQSGVIRAS LEGGDSALTA AIVNSMAREF VRQDVESRST EAEHMLAFLD       300
     QQLPGLRKEL DDAEQRYNKF RNTHGTVDLG EESRLLLQQI VDNKTKLMDL QQQRAEMSQR       360
     FTANHPAVAA LDAQIAALQG AAANMNRSVA VMPDTEQTAL RLLRDVHVDT ELYTNLLNSA       420
     QQLRVAKAGQ VGSVRVVDFA EAPDDPVRPK RVIAILIALG GGLVLGILLT FFKRAMYGGV       480
     ERPDELEGML GVPVFAVVPR SQTQLKLQEN VMLRRRGLHV LAQQAPEDIA VEGVRNLRTS       540
     LQLSLDHAEN NVVMITGSRP DSGKSFLSVN LAALVASANK RVLIIDGDMR RGDVHSHFGI       600
     GHQPGLSDVL SGGDLNAMIQ RDVLPGLDVL AKGTLPSHPA ELLMSKRFET MLEELKSHYD       660
     LVIVDTPPVL AVTDSTLIGK YAGTTLLVVR HGRHPLNEVM ETAKRLRNGG VALRGVLLTD       720
     VPQEGAFLGS GYQGGYYGYD SIAG                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page