(data stored in ACNUC7421 zone)

EMBL: CP000270.PE602

CP000270.PE602       Location/Qualifiers
FT   CDS             679453..680073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3858"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3858"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29140"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U9"
FT                   /protein_id="ABE29140.1"
FT                   /translation="MGNVADDPQIGRLPQAGDARKDGRVINLRQAGKGNYQARRGALVE
FT                   LIWFVLEACVINNKLLPLSSVRVALLRLFGAKIGTGCRFVHPVRVKAPWNLEVGDNCWF
FT                   GVDVWIYNQTLIRIGSNVCISQGTFLTAGSHDMSTTMDLHVAPIVIEDGVWITSKCVVQ
FT                   MGVTIGRSAVVTPLSVVHRSLEAEGVYGGNPCRFIRKRFDSVT"
     MGNVADDPQI GRLPQAGDAR KDGRVINLRQ AGKGNYQARR GALVELIWFV LEACVINNKL        60
     LPLSSVRVAL LRLFGAKIGT GCRFVHPVRV KAPWNLEVGD NCWFGVDVWI YNQTLIRIGS       120
     NVCISQGTFL TAGSHDMSTT MDLHVAPIVI EDGVWITSKC VVQMGVTIGR SAVVTPLSVV       180
     HRSLEAEGVY GGNPCRFIRK RFDSVT                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page