(data stored in ACNUC7421 zone)

EMBL: CP000270.PE607

CP000270.PE607       Location/Qualifiers
FT   CDS             complement(686515..688209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3853"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3853"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29145"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U4"
FT                   /protein_id="ABE29145.1"
FT                   /translation="MLMIHRGRSCLFQSRLSGRAARSALVVLLAFSSGSYAQVKLQLVN
FT                   APGSQVTPASGKKVLRFEVLPPDIPRATKITVGVYPYDSDGKVLPTRLASYENTIGRMQ
FT                   DDKAFNVAVTIPRMGLFRIEATLKSPDGETLDKTTSTLAIVTKRTELGPPDFGVGTHFG
FT                   QDGTPPPSVLLPLVKQAGFSWIRDDIYWDTVEKKAGVFVFPKRYDAYLALSKQLGISPL
FT                   VVLDEGNPRAYPKLFSKSNFPLSPEARARFADYVDAVVARYGDNAVTAPYGGAVQYWEV
FT                   WNEPDFSKISYADYAALLWETFGAIKDVNPAASVIACGGGGAGGGPGGDCVVGLIKEGA
FT                   LNDQSGFSIHPYMSPHTPEKGYKTEGAPIDFVNIPTVWPYLRDFTADHMKTDGRPLQVW
FT                   VTEMGWPVNPKEPGQDEATQAANLVRSYLLSRRYGTVRVLFWYDFVDDGTDLDNIEHNF
FT                   GLLHHDLTPKPAFVAASVLSSTVGKRAWAKALVDDESVKAYQYGTDDPVFVGWTVDGSQ
FT                   RVASISLPPGEYIQRDWQGVDTPVTITAQNFRWRVGPVPRYLMPARR"
     MLMIHRGRSC LFQSRLSGRA ARSALVVLLA FSSGSYAQVK LQLVNAPGSQ VTPASGKKVL        60
     RFEVLPPDIP RATKITVGVY PYDSDGKVLP TRLASYENTI GRMQDDKAFN VAVTIPRMGL       120
     FRIEATLKSP DGETLDKTTS TLAIVTKRTE LGPPDFGVGT HFGQDGTPPP SVLLPLVKQA       180
     GFSWIRDDIY WDTVEKKAGV FVFPKRYDAY LALSKQLGIS PLVVLDEGNP RAYPKLFSKS       240
     NFPLSPEARA RFADYVDAVV ARYGDNAVTA PYGGAVQYWE VWNEPDFSKI SYADYAALLW       300
     ETFGAIKDVN PAASVIACGG GGAGGGPGGD CVVGLIKEGA LNDQSGFSIH PYMSPHTPEK       360
     GYKTEGAPID FVNIPTVWPY LRDFTADHMK TDGRPLQVWV TEMGWPVNPK EPGQDEATQA       420
     ANLVRSYLLS RRYGTVRVLF WYDFVDDGTD LDNIEHNFGL LHHDLTPKPA FVAASVLSST       480
     VGKRAWAKAL VDDESVKAYQ YGTDDPVFVG WTVDGSQRVA SISLPPGEYI QRDWQGVDTP       540
     VTITAQNFRW RVGPVPRYLM PARR                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page