(data stored in ACNUC7421 zone)

EMBL: CP000270.PE608

CP000270.PE608       Location/Qualifiers
FT   CDS             688497..688874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3852"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3852"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29146"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U3"
FT                   /protein_id="ABE29146.1"
FT                   /translation="MRCLPLSVGRGHLNEACLAGLASSVRLSTYVRSRCWGALRNPHGF
FT                   ARFPTTRRDCAAAYGQRITRLKKIQLFSGEAVVASIRSVGMIFHRVRPVVVALRVGILI
FT                   LADYQIIIHTNKNALTIRMNK"
     MRCLPLSVGR GHLNEACLAG LASSVRLSTY VRSRCWGALR NPHGFARFPT TRRDCAAAYG        60
     QRITRLKKIQ LFSGEAVVAS IRSVGMIFHR VRPVVVALRV GILILADYQI IIHTNKNALT       120
     IRMNK                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page