(data stored in ACNUC7421 zone)

EMBL: CP000270.PE615

CP000270.PE615       Location/Qualifiers
FT   CDS             complement(698599..699723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3845"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3845"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29153"
FT                   /db_xref="UniProtKB/TrEMBL:Q144T6"
FT                   /protein_id="ABE29153.1"
FT                   /translation="MLSDLTSDQHDSPRCGHCGVPLAGRFTPCPSCHQRPVDAPRAHAA
FT                   PRPSLKVPLNEPLNDPQSLVDSRLPARKLWDPSSRALVNSYEFVEEPAVAVSAYQRLRQ
FT                   PLVVAASALTVTSAVYLGFIHSNDSKVGTPIAVSGKVQTQNAAPLAVVPQQPAAAVTQR
FT                   SATAIPQKSITILAQTPAAAVPQKPAAIVVAQKPASGAAIRSAPVRSPPAPPAAATPPL
FT                   SRRVASVEPDAKRNPGGQSGKPPDKPRADVSRHLRAARADLQQNNLSATRVRLAAAISV
FT                   QPDNRDALNMRATLNAREQQRDALLSLARGCGYIARWNCVSHNAGTALQIDSSSKEAQR
FT                   LVMLAQHEAQLQIPPPVEPAPEPAPDMRDLNSHH"
     MLSDLTSDQH DSPRCGHCGV PLAGRFTPCP SCHQRPVDAP RAHAAPRPSL KVPLNEPLND        60
     PQSLVDSRLP ARKLWDPSSR ALVNSYEFVE EPAVAVSAYQ RLRQPLVVAA SALTVTSAVY       120
     LGFIHSNDSK VGTPIAVSGK VQTQNAAPLA VVPQQPAAAV TQRSATAIPQ KSITILAQTP       180
     AAAVPQKPAA IVVAQKPASG AAIRSAPVRS PPAPPAAATP PLSRRVASVE PDAKRNPGGQ       240
     SGKPPDKPRA DVSRHLRAAR ADLQQNNLSA TRVRLAAAIS VQPDNRDALN MRATLNAREQ       300
     QRDALLSLAR GCGYIARWNC VSHNAGTALQ IDSSSKEAQR LVMLAQHEAQ LQIPPPVEPA       360
     PEPAPDMRDL NSHH                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page