(data stored in ACNUC7421 zone)

EMBL: CP000270.PE623

CP000270.PE623       Location/Qualifiers
FT   CDS             707718..708788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3837"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3837"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29161"
FT                   /db_xref="GOA:Q144S8"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S8"
FT                   /protein_id="ABE29161.1"
FT                   /translation="MASRFGVTAGGVVSTFDKLGRPLRDLRLSVIDQCNFRCTYCMPRE
FT                   TFGADYPFLASSERMSFEQILKLAKAFTLLGVEKIRITGGEPLLRRGLESLIEQLAKLT
FT                   TASGKPVELALTTNGSLLAAKARSLRDAGLGRVTVSLDAVEDAVFRRMSDVDMSVARIL
FT                   DGIEAARAVGLEPIKVNSVIERGVNESQILPLVRQFRGTGVAVRFIEYMDVGGAGGWSN
FT                   TKVMTAREIRGIVESEFPLVPVVVREQSGTAVNYLHADGAGEVGFIASVSQPFCGSCSR
FT                   ARVSADGQLYSCLFATHGTDLRPWLTDTATAGQLAERVRSRWTQRDDRYSELRSTQRKP
FT                   ASGKVYPTVRMSLVGG"
     MASRFGVTAG GVVSTFDKLG RPLRDLRLSV IDQCNFRCTY CMPRETFGAD YPFLASSERM        60
     SFEQILKLAK AFTLLGVEKI RITGGEPLLR RGLESLIEQL AKLTTASGKP VELALTTNGS       120
     LLAAKARSLR DAGLGRVTVS LDAVEDAVFR RMSDVDMSVA RILDGIEAAR AVGLEPIKVN       180
     SVIERGVNES QILPLVRQFR GTGVAVRFIE YMDVGGAGGW SNTKVMTARE IRGIVESEFP       240
     LVPVVVREQS GTAVNYLHAD GAGEVGFIAS VSQPFCGSCS RARVSADGQL YSCLFATHGT       300
     DLRPWLTDTA TAGQLAERVR SRWTQRDDRY SELRSTQRKP ASGKVYPTVR MSLVGG           356
//

If you have problems or comments...

PBIL Back to PBIL home page