(data stored in ACNUC7421 zone)

EMBL: CP000270.PE626

CP000270.PE626       Location/Qualifiers
FT   CDS             complement(711716..712519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3834"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3834"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29164"
FT                   /db_xref="GOA:Q144S5"
FT                   /db_xref="InterPro:IPR007544"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S5"
FT                   /protein_id="ABE29164.1"
FT                   /translation="MNNLHRELAPISRAAWSQIEDEVARTFRRSVAGRRVVDVKGPGGT
FT                   ELSGVGTGHQTAIAAPQQGVVAKLSEVKSLVELTVPFELQREAIDSVVRGAKDADWQPA
FT                   KEAAKQLAYAEDRAIFDGYQAAGIGGIREGSSNPSLALPADVSDYPNAISNALEQLRLA
FT                   GVDGPYSVLLGADAYTALGEARDQGYPVIEHIKRIVNGDIIWAPALAGGSVLSTRGGDF
FT                   ELHLGEDLSIGYTSHTDTVVRLYLRETLTFLMLTSEASVSVTQAE"
     MNNLHRELAP ISRAAWSQIE DEVARTFRRS VAGRRVVDVK GPGGTELSGV GTGHQTAIAA        60
     PQQGVVAKLS EVKSLVELTV PFELQREAID SVVRGAKDAD WQPAKEAAKQ LAYAEDRAIF       120
     DGYQAAGIGG IREGSSNPSL ALPADVSDYP NAISNALEQL RLAGVDGPYS VLLGADAYTA       180
     LGEARDQGYP VIEHIKRIVN GDIIWAPALA GGSVLSTRGG DFELHLGEDL SIGYTSHTDT       240
     VVRLYLRETL TFLMLTSEAS VSVTQAE                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page