(data stored in ACNUC7421 zone)

EMBL: CP000270.PE63

CP000270.PE63        Location/Qualifiers
FT   CDS             complement(79407..80516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4399"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4399"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28601"
FT                   /db_xref="GOA:Q146Y8"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Y8"
FT                   /protein_id="ABE28601.1"
FT                   /translation="MEYSPPPLFKQGPSALARLVFFVVLALALLISDARFKTLEIVRGV
FT                   LGAGLYPLQRAALVPRDMFVGAADLAVTSATLRSENDKLRAKDLQLSQQANTAAELAAE
FT                   NAHLRALLQLSQRSTTQSLPAEIQYDTRDPFTQKVVIGRGAQQGIQNGSPVVNEDGVIG
FT                   QVTRVFPLQAEVTLLTDKDQAVPVQVVRTGLRSVIYGTPKGDTLDLRFVPISADIQSGD
FT                   ELVTSGLDGVYPPGLPVARVVRVDKQADTAFARVICLPVAPVRGARQLLVLHYVNNVPP
FT                   RPAEEPDAATAAKDAKAKKGGKPADGKAAADKAPAKAGEKPAAEKPATARPAEKAPAKP
FT                   AAAEKKSAAEKKPAAEKNAKPQATPGAQP"
     MEYSPPPLFK QGPSALARLV FFVVLALALL ISDARFKTLE IVRGVLGAGL YPLQRAALVP        60
     RDMFVGAADL AVTSATLRSE NDKLRAKDLQ LSQQANTAAE LAAENAHLRA LLQLSQRSTT       120
     QSLPAEIQYD TRDPFTQKVV IGRGAQQGIQ NGSPVVNEDG VIGQVTRVFP LQAEVTLLTD       180
     KDQAVPVQVV RTGLRSVIYG TPKGDTLDLR FVPISADIQS GDELVTSGLD GVYPPGLPVA       240
     RVVRVDKQAD TAFARVICLP VAPVRGARQL LVLHYVNNVP PRPAEEPDAA TAAKDAKAKK       300
     GGKPADGKAA ADKAPAKAGE KPAAEKPATA RPAEKAPAKP AAAEKKSAAE KKPAAEKNAK       360
     PQATPGAQP                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page