(data stored in ACNUC7421 zone)

EMBL: CP000270.PE630

CP000270.PE630       Location/Qualifiers
FT   CDS             complement(714740..714988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3830"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29168"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S1"
FT                   /protein_id="ABE29168.1"
FT                   /translation="MGRSGFTSIARTDVSHHQLEQDLAHLEHIFPQLVANSALGLGYWR
FT                   QRITALETEQGSLPDGARRVTRLLSMIDQIDDAIRLP"
     MGRSGFTSIA RTDVSHHQLE QDLAHLEHIF PQLVANSALG LGYWRQRITA LETEQGSLPD        60
     GARRVTRLLS MIDQIDDAIR LP                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page