(data stored in ACNUC7421 zone)

EMBL: CP000270.PE632

CP000270.PE632       Location/Qualifiers
FT   CDS             complement(718165..719250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3828"
FT                   /product="Conserved hypothetical protein 374"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3828"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29170"
FT                   /db_xref="GOA:Q144R9"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R9"
FT                   /protein_id="ABE29170.1"
FT                   /translation="MSTPQRRSASTPLMPESGALPPPAKPGVETGLVRIAPGLLGKTSR
FT                   LRSVMVWVVGVMGCIAVILVVLHLGSLQKMAELIRSARPGWMLVALAVQCGTYVSAAFV
FT                   WRQTLREAGHPLSLRTLTPLGIAKVFTDQVLPSGGISGTMLVVRGLTGRHVPAGIAMAA
FT                   MLVGMVSYDIAYLLVVLASAGMLWWQHRLNTALVIGVAVFVVVTVAVPAAVLGLKQWGQ
FT                   RAPIAWLSKWLGVTTLLRQLTDAPTHLLRSPRLLLQTVGLQLAIFVCDALTLWLAFNAI
FT                   GEVPPLWVVFVSFIIASMVATIGPIPVGLGTFEATSVGMLNLLGVSVEAALAATLLLRA
FT                   LTFWLPMLPGIWLARREIRLH"
     MSTPQRRSAS TPLMPESGAL PPPAKPGVET GLVRIAPGLL GKTSRLRSVM VWVVGVMGCI        60
     AVILVVLHLG SLQKMAELIR SARPGWMLVA LAVQCGTYVS AAFVWRQTLR EAGHPLSLRT       120
     LTPLGIAKVF TDQVLPSGGI SGTMLVVRGL TGRHVPAGIA MAAMLVGMVS YDIAYLLVVL       180
     ASAGMLWWQH RLNTALVIGV AVFVVVTVAV PAAVLGLKQW GQRAPIAWLS KWLGVTTLLR       240
     QLTDAPTHLL RSPRLLLQTV GLQLAIFVCD ALTLWLAFNA IGEVPPLWVV FVSFIIASMV       300
     ATIGPIPVGL GTFEATSVGM LNLLGVSVEA ALAATLLLRA LTFWLPMLPG IWLARREIRL       360
     H                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page