(data stored in ACNUC7421 zone)

EMBL: CP000270.PE637

CP000270.PE637       Location/Qualifiers
FT   CDS             complement(724326..724658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3823"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3823"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29175"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R4"
FT                   /protein_id="ABE29175.1"
FT                   /translation="MRCRADRGPRRIRTVPDQSKTKVPGSIKTREQVMRQNIQKLCQAR
FT                   IHTFTPECVELQDGTFDFHLRHAVEGTLPSADRHYEVGVFSTSEEGYAAALAYGDKYIA
FT                   EHKFGM"
     MRCRADRGPR RIRTVPDQSK TKVPGSIKTR EQVMRQNIQK LCQARIHTFT PECVELQDGT        60
     FDFHLRHAVE GTLPSADRHY EVGVFSTSEE GYAAALAYGD KYIAEHKFGM                  110
//

If you have problems or comments...

PBIL Back to PBIL home page