(data stored in ACNUC7421 zone)

EMBL: CP000270.PE64

CP000270.PE64        Location/Qualifiers
FT   CDS             complement(80670..81713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4398"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4398"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28602"
FT                   /db_xref="GOA:Q146Y7"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Y7"
FT                   /protein_id="ABE28602.1"
FT                   /translation="MFGFLRSYFSNDLAIDLGTANTLIYMRGKGIVLDEPSVVSIRQEG
FT                   GPNGKKTIQAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMIKQFIKTAHESRM
FT                   FSPSPRIIICVPCGSTQVERRAIKEAAHGAGASQVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVGVISLGGIVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEAIKKE
FT                   IGSAFPGSEVKEMEVKGRNLSEGIPRSFTISSNEILEALTDPLNQIVSSVKIALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMALERMDKL
FT                   GSIFSYE"
     MFGFLRSYFS NDLAIDLGTA NTLIYMRGKG IVLDEPSVVS IRQEGGPNGK KTIQAVGKEA        60
     KQMLGKVPGN IEAIRPMKDG VIADFTVTEQ MIKQFIKTAH ESRMFSPSPR IIICVPCGST       120
     QVERRAIKEA AHGAGASQVY LIEEPMAAAI GAGLPVSEAT GSMVVDIGGG TTEVGVISLG       180
     GIVYKGSVRV GGDKFDEAIV NYIRRNYGML IGEQTAEAIK KEIGSAFPGS EVKEMEVKGR       240
     NLSEGIPRSF TISSNEILEA LTDPLNQIVS SVKIALEQTP PELGADIAER GMMLTGGGAL       300
     LRDLDRLLAE ETGLPVLVAE DPLTCVVRGS GMALERMDKL GSIFSYE                     347
//

If you have problems or comments...

PBIL Back to PBIL home page