(data stored in ACNUC7421 zone)

EMBL: CP000270.PE640

CP000270.PE640       Location/Qualifiers
FT   CDS             726573..727292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3820"
FT                   /product="Cyclic nucleotide-binding domain (cNMP-BD)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3820"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29178"
FT                   /db_xref="GOA:Q144R1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R1"
FT                   /protein_id="ABE29178.1"
FT                   /translation="MAQGHQENENHLLAVLPDLEWERLAPHLVLMDMPLGNVVYESGDR
FT                   LNYVYFPTTCIVSLLYVMEDGASAEIAIVGNEGLIGIALFMGGETTPSRAVVQSAGKAY
FT                   RLDAQILKEEFHRAGPVQRLLLRYTQALITQMAQTAVCNRHHSIDQQLCRWLLLSIDRL
FT                   SSNELKMTQELIANMLGVRRSGVTEAALKLQDAGLIRYSHGHIEVQDRPGLEKRVCECY
FT                   GVVKREFDRLLPALKAL"
     MAQGHQENEN HLLAVLPDLE WERLAPHLVL MDMPLGNVVY ESGDRLNYVY FPTTCIVSLL        60
     YVMEDGASAE IAIVGNEGLI GIALFMGGET TPSRAVVQSA GKAYRLDAQI LKEEFHRAGP       120
     VQRLLLRYTQ ALITQMAQTA VCNRHHSIDQ QLCRWLLLSI DRLSSNELKM TQELIANMLG       180
     VRRSGVTEAA LKLQDAGLIR YSHGHIEVQD RPGLEKRVCE CYGVVKREFD RLLPALKAL        239
//

If you have problems or comments...

PBIL Back to PBIL home page