(data stored in ACNUC7421 zone)

EMBL: CP000270.PE646

CP000270.PE646       Location/Qualifiers
FT   CDS             complement(731091..731951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3814"
FT                   /product="Putative hydroxymethylpyrimidine kinase"
FT                   /EC_number="2.7.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3814"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29184"
FT                   /db_xref="GOA:Q144Q5"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Q5"
FT                   /protein_id="ABE29184.1"
FT                   /translation="MPSDTPPIVLTFGLSDPTGGSGLQADLMTLASMGCHGVSVLTGYT
FT                   VRDSASCDEVTGLDPEVVATQARMLLEDMPIAAFKVGACTRAEVVSAIAEVVADYDDIP
FT                   LILAPDFTLDDEHVLSADELREAIADLLAPQTTLLVADATTLLALAQPDGDAEAPSLDA
FT                   AISHLLSQGCEYILSTETGTHRHVNTLFSEDGQLRQDMWDRGSHRIMGLTDTLGSAIAA
FT                   LLANGQEPAEAVREAQEYLYQAVRNAFRPGMGAYMPDRFFWARSSDDETPPAAGKDAAP
FT                   GEARH"
     MPSDTPPIVL TFGLSDPTGG SGLQADLMTL ASMGCHGVSV LTGYTVRDSA SCDEVTGLDP        60
     EVVATQARML LEDMPIAAFK VGACTRAEVV SAIAEVVADY DDIPLILAPD FTLDDEHVLS       120
     ADELREAIAD LLAPQTTLLV ADATTLLALA QPDGDAEAPS LDAAISHLLS QGCEYILSTE       180
     TGTHRHVNTL FSEDGQLRQD MWDRGSHRIM GLTDTLGSAI AALLANGQEP AEAVREAQEY       240
     LYQAVRNAFR PGMGAYMPDR FFWARSSDDE TPPAAGKDAA PGEARH                      286
//

If you have problems or comments...

PBIL Back to PBIL home page