(data stored in ACNUC7421 zone)

EMBL: CP000270.PE648

CP000270.PE648       Location/Qualifiers
FT   CDS             732681..734093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3812"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3812"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29186"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Q3"
FT                   /protein_id="ABE29186.1"
FT                   /translation="MTLRSAAPVSFDALPNPRGGAVRPAELALAEALLAFEQHGESTSA
FT                   LLRASHALRGAGWLSAQRFADALVRLSPLAAGDPAEAASARPVFGAALRDFRAALERHN
FT                   LRELSCSPVLFDHYRALCAHLSEHTPGSTVAFEDLALTARPVPPVSLHARSADQLAHLR
FT                   ARYERALLPVLRSQADTGSAAALAVTNAALDELDAVFSELAGPDPYDFWRLAKACGKAL
FT                   RAGGRAAGETDARRFYARCNLALADHARGIELAPRSLVRATLALLWRDYALFGAAAEDA
FT                   DQVELLHDYGLTVDWHVAGTQASEMLWEAGALQAQAVSATRSALTRELGVLTVNANAYE
FT                   DFLQTADASIAALTEHARAADQPEKADPSEALQAGDAAYRLGSAACALGLGHVALLADA
FT                   LGLAWRRRAHAGVSTPAVRAHVIVGAPAASTLEQAAEALRATLHKVAAGVAPAGGNAAL
FT                   AALTRSIEQGGA"
     MTLRSAAPVS FDALPNPRGG AVRPAELALA EALLAFEQHG ESTSALLRAS HALRGAGWLS        60
     AQRFADALVR LSPLAAGDPA EAASARPVFG AALRDFRAAL ERHNLRELSC SPVLFDHYRA       120
     LCAHLSEHTP GSTVAFEDLA LTARPVPPVS LHARSADQLA HLRARYERAL LPVLRSQADT       180
     GSAAALAVTN AALDELDAVF SELAGPDPYD FWRLAKACGK ALRAGGRAAG ETDARRFYAR       240
     CNLALADHAR GIELAPRSLV RATLALLWRD YALFGAAAED ADQVELLHDY GLTVDWHVAG       300
     TQASEMLWEA GALQAQAVSA TRSALTRELG VLTVNANAYE DFLQTADASI AALTEHARAA       360
     DQPEKADPSE ALQAGDAAYR LGSAACALGL GHVALLADAL GLAWRRRAHA GVSTPAVRAH       420
     VIVGAPAAST LEQAAEALRA TLHKVAAGVA PAGGNAALAA LTRSIEQGGA                  470
//

If you have problems or comments...

PBIL Back to PBIL home page