(data stored in ACNUC7421 zone)

EMBL: CP000270.PE649

CP000270.PE649       Location/Qualifiers
FT   CDS             734284..734949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3811"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3811"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29187"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q144Q2"
FT                   /protein_id="ABE29187.1"
FT                   /translation="MAHGSLHGTHRGSTLKAPPSCIVFAKIRTMSKSTDRINLTNQFLI
FT                   AMPNMADPTFSGTVVYLCDHSERGALGLVINRPTDIDLQALFSRIDLKLEIEPLLHVPV
FT                   YFGGPVQTERGFVLHDPKDGNAYTSSMSVPGGLEMTTSKDVLEAVASGTGPERFLLTLG
FT                   HAGWGAGQLEEEISKNGWLTVEADPKIVFDVPAEERLEAALALLGINLSMLSGEAGHA"
     MAHGSLHGTH RGSTLKAPPS CIVFAKIRTM SKSTDRINLT NQFLIAMPNM ADPTFSGTVV        60
     YLCDHSERGA LGLVINRPTD IDLQALFSRI DLKLEIEPLL HVPVYFGGPV QTERGFVLHD       120
     PKDGNAYTSS MSVPGGLEMT TSKDVLEAVA SGTGPERFLL TLGHAGWGAG QLEEEISKNG       180
     WLTVEADPKI VFDVPAEERL EAALALLGIN LSMLSGEAGH A                           221
//

If you have problems or comments...

PBIL Back to PBIL home page