(data stored in ACNUC7421 zone)

EMBL: CP000270.PE662

CP000270.PE662       Location/Qualifiers
FT   CDS             746227..747573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3798"
FT                   /product="ABC O-antigen/lipopolysaccharide exporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3798"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29200"
FT                   /db_xref="GOA:Q144N9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:Q144N9"
FT                   /protein_id="ABE29200.1"
FT                   /translation="MSSEIVIRVKNLSKCFNIYDQPRDRLKQAILPRLQRLFGRPQKSY
FT                   HKEFWALRNADFEIRRGETVGIIGRNGSGKSTLLQLLCGTLTPTHGDIEVTGKVAALLE
FT                   LGAGFNPEFTGRENVFLSGSFYGLTREQVQERFDRIAAFADIGDHIEQPVKTYSSGMFV
FT                   RLAFAVIAHVDADILVIDEALSVGDAVFTQKCMRFIRSFQEKGTLLFVSHDMQSVVNLC
FT                   RNAIWLNAGETRMKGTSKNVSEAYLKYTLQEVYGEEAILLSAAPKESTLDAPMFEEAGP
FT                   PMLDYEAVASVSSNLFDAKGWKTGDAEIEAVQLESLTGENDGILRGGELVRMVVRARAH
FT                   QPLERPVIGFMVRDRLGQNLFGENTLSLTALDQARVAAGQMFEGEFVFRLPMLPDGQYS
FT                   VTASVADGDLHNNVQHHLLHDALIINVASSKVRWGLVGVPFERVTLNCI"
     MSSEIVIRVK NLSKCFNIYD QPRDRLKQAI LPRLQRLFGR PQKSYHKEFW ALRNADFEIR        60
     RGETVGIIGR NGSGKSTLLQ LLCGTLTPTH GDIEVTGKVA ALLELGAGFN PEFTGRENVF       120
     LSGSFYGLTR EQVQERFDRI AAFADIGDHI EQPVKTYSSG MFVRLAFAVI AHVDADILVI       180
     DEALSVGDAV FTQKCMRFIR SFQEKGTLLF VSHDMQSVVN LCRNAIWLNA GETRMKGTSK       240
     NVSEAYLKYT LQEVYGEEAI LLSAAPKEST LDAPMFEEAG PPMLDYEAVA SVSSNLFDAK       300
     GWKTGDAEIE AVQLESLTGE NDGILRGGEL VRMVVRARAH QPLERPVIGF MVRDRLGQNL       360
     FGENTLSLTA LDQARVAAGQ MFEGEFVFRL PMLPDGQYSV TASVADGDLH NNVQHHLLHD       420
     ALIINVASSK VRWGLVGVPF ERVTLNCI                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page