(data stored in ACNUC7421 zone)

EMBL: CP000270.PE663

CP000270.PE663       Location/Qualifiers
FT   CDS             747570..751904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3797"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3797"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29201"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q144N8"
FT                   /protein_id="ABE29201.1"
FT                   /translation="MMKSIRQLYKEHEGKVSDKWSLYLDEYNRLFAPYRDQPIRMLEIG
FT                   IQNGGSLEIWSKYFAQARTLVGCDINPDCSKLIYADPRISVVVGDANTDESAAEILGHS
FT                   ARFDVVIDDGSHRSSDIVRSFARYFPALNDGGIFVAEDLHCSYWQDFEGGLYDPYSSIN
FT                   FFKRIADVVNHEHWGVAKANRTVLQGMFKRYGCELSDAELDRIHSVEFINSICVIRKAP
FT                   PDQNRLGKRFIAGELEVVVPGHRALLGTDADVPDQSANPWTVMAMPPDEEYELLKTQIE
FT                   YLKRAASVHDQELRARDTVIRQRDQEIERLNGVVNEFKNEIGKYHGVVMSRDAELEAIR
FT                   TSNSWRITAPLRRVGGVAPKLRYRVGGVAGLVRRHGVGYLAGKAWDIFRQQGAGGLRQR
FT                   ASLTLRQHHLSVAPPVALRHPEANYFPVTPVDRPPLPAVTVDVVIPVYRGLDETRKCIE
FT                   SVLKAHCAANMRVIVIDDASPEPAVSAYLDSLPQTPEFKVMRNEVNLGFVKTVNRGMRL
FT                   EPANDIVLLNSDTEVADGWLDRLVWHAYSQSKIASVTPFSNNATICSYPTIYGTRVLPH
FT                   GETLEALNQAFYTANAGRAVELPTGVGFCMYIRRACLDELGLFDEEAFGKGYGEENDFC
FT                   LRALARGWTHLLATDTFVYHAGEVSFADSSSPGKARAMEVLRERYPDYETRIVEHVTQG
FT                   DAEPFRIAATAARFRLSRKPVTLMIGHHLGGGTEKHLLDLADSLVPDAFCLVLSPASDV
FT                   ANRIVLRAANVADSFELPLDLPQHERFLWELLKSFGVTRVHFHHLLGLPESVREVVRQL
FT                   GVPHDFTVHDYYTICPQVNLAIEGRYCGEPENGKCNACIAKRPSHGAQDIDWWRQKHAW
FT                   VIDDAARVMCPTHDVAQRIRRYRPAANTVVASHECAAPVPVKAPTLSADEPLRVVMLGW
FT                   LATHKGGPLVAECVDFARRQKRPMHFHLIGRSVDPIETSSTYSETGEYTDDNVQSLITE
FT                   ADPHLIWLPSTWPETYSYTLSAALTAGVPVAAPNIGAFPERLSGRDWSWIVPWDSTALQ
FT                   MLDFFEEARAFLERGLSPAPGEGGEAPPQGFYNGAYQAELTNAQVTPIDLRRPGVPSVL
FT                   AVVETYGKHASPCAYIRVLLPLLKIASKRPLTVKVVEADYLSDYVADVVYTHRVALSGG
FT                   DALTAVEHCRRNDMRLVYDLDDDLLAIAESDHPEREAYAGYAQSIRLLVSEASSVHVST
FT                   DPLRQKLAAFSRHVKLVPNALDDGLWHLSDARPARASGQSVSILYMGTQTHAVDFEMVK
FT                   PALARLKSKYRDQVRICVIGVTQDREKSDVYEFVDAPSRVSGSYAAFVEWLVEKGNFDI
FT                   GIAPLLDSEFNAGKSGIKFLDYAALGLAIACSDVRSYRSVVRHEETGVLVKNDENAWYE
FT                   ALDRLVSDSQYRTRLATNGRADLIAHHTLSSVYENFPGMWLL"
     MMKSIRQLYK EHEGKVSDKW SLYLDEYNRL FAPYRDQPIR MLEIGIQNGG SLEIWSKYFA        60
     QARTLVGCDI NPDCSKLIYA DPRISVVVGD ANTDESAAEI LGHSARFDVV IDDGSHRSSD       120
     IVRSFARYFP ALNDGGIFVA EDLHCSYWQD FEGGLYDPYS SINFFKRIAD VVNHEHWGVA       180
     KANRTVLQGM FKRYGCELSD AELDRIHSVE FINSICVIRK APPDQNRLGK RFIAGELEVV       240
     VPGHRALLGT DADVPDQSAN PWTVMAMPPD EEYELLKTQI EYLKRAASVH DQELRARDTV       300
     IRQRDQEIER LNGVVNEFKN EIGKYHGVVM SRDAELEAIR TSNSWRITAP LRRVGGVAPK       360
     LRYRVGGVAG LVRRHGVGYL AGKAWDIFRQ QGAGGLRQRA SLTLRQHHLS VAPPVALRHP       420
     EANYFPVTPV DRPPLPAVTV DVVIPVYRGL DETRKCIESV LKAHCAANMR VIVIDDASPE       480
     PAVSAYLDSL PQTPEFKVMR NEVNLGFVKT VNRGMRLEPA NDIVLLNSDT EVADGWLDRL       540
     VWHAYSQSKI ASVTPFSNNA TICSYPTIYG TRVLPHGETL EALNQAFYTA NAGRAVELPT       600
     GVGFCMYIRR ACLDELGLFD EEAFGKGYGE ENDFCLRALA RGWTHLLATD TFVYHAGEVS       660
     FADSSSPGKA RAMEVLRERY PDYETRIVEH VTQGDAEPFR IAATAARFRL SRKPVTLMIG       720
     HHLGGGTEKH LLDLADSLVP DAFCLVLSPA SDVANRIVLR AANVADSFEL PLDLPQHERF       780
     LWELLKSFGV TRVHFHHLLG LPESVREVVR QLGVPHDFTV HDYYTICPQV NLAIEGRYCG       840
     EPENGKCNAC IAKRPSHGAQ DIDWWRQKHA WVIDDAARVM CPTHDVAQRI RRYRPAANTV       900
     VASHECAAPV PVKAPTLSAD EPLRVVMLGW LATHKGGPLV AECVDFARRQ KRPMHFHLIG       960
     RSVDPIETSS TYSETGEYTD DNVQSLITEA DPHLIWLPST WPETYSYTLS AALTAGVPVA      1020
     APNIGAFPER LSGRDWSWIV PWDSTALQML DFFEEARAFL ERGLSPAPGE GGEAPPQGFY      1080
     NGAYQAELTN AQVTPIDLRR PGVPSVLAVV ETYGKHASPC AYIRVLLPLL KIASKRPLTV      1140
     KVVEADYLSD YVADVVYTHR VALSGGDALT AVEHCRRNDM RLVYDLDDDL LAIAESDHPE      1200
     REAYAGYAQS IRLLVSEASS VHVSTDPLRQ KLAAFSRHVK LVPNALDDGL WHLSDARPAR      1260
     ASGQSVSILY MGTQTHAVDF EMVKPALARL KSKYRDQVRI CVIGVTQDRE KSDVYEFVDA      1320
     PSRVSGSYAA FVEWLVEKGN FDIGIAPLLD SEFNAGKSGI KFLDYAALGL AIACSDVRSY      1380
     RSVVRHEETG VLVKNDENAW YEALDRLVSD SQYRTRLATN GRADLIAHHT LSSVYENFPG      1440
     MWLL                                                                   1444
//

If you have problems or comments...

PBIL Back to PBIL home page