(data stored in ACNUC7421 zone)

EMBL: CP000270.PE664

CP000270.PE664       Location/Qualifiers
FT   CDS             752028..753653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3796"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3796"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29202"
FT                   /db_xref="GOA:Q144N7"
FT                   /db_xref="UniProtKB/TrEMBL:Q144N7"
FT                   /protein_id="ABE29202.1"
FT                   /translation="MRELSPQTMDVRVDESTEARLSSKGWIAVAALAVVTYFIRDCYQF
FT                   LKPQFWAEDATIFLAMSVREALLNLVHPYAGYFHFAPRTLALLGAFFPTVLAPAVFYYG
FT                   AVAAAVASCVAIYLMVGTFPTHLRILFALAPMLVLPAGEVYGNVTNIQWFFGVAFGVLV
FT                   LTYRGDTFRSRGWLVMGEVLALTGPFSVVFWPCLLVWSWLTGRLPVNAKMLVVVGIGAF
FT                   VQLAAVVLMGVNKYGVGIAAASAWVRAVKIFVGSFVTLSGVTGGVAVLAIFVLLAFGLR
FT                   RNFVERLRGGYLPFGLVCMALLTLLMGLWTHKHMPDEINPLGPGERYFFLPFNFLFMAV
FT                   IASAQAVGKKYHWFCLVVALSLVFGWSRHFRKGELSDFRWRDYYALSQVTQDSLIPIQP
FT                   GWVLRLNNDRPDRLVSVMPVDLSRLEPFYGVLHTDGDETTLIEERVSGDPASQIVFDVP
FT                   SSCLKTEHRFVRVALKDAARVHLYLPDVNDISSKSASLIWHVGANDHWYFDVPNRVSTK
FT                   IVRLGVTSDSGGIVRGLKLSWVCW"
     MRELSPQTMD VRVDESTEAR LSSKGWIAVA ALAVVTYFIR DCYQFLKPQF WAEDATIFLA        60
     MSVREALLNL VHPYAGYFHF APRTLALLGA FFPTVLAPAV FYYGAVAAAV ASCVAIYLMV       120
     GTFPTHLRIL FALAPMLVLP AGEVYGNVTN IQWFFGVAFG VLVLTYRGDT FRSRGWLVMG       180
     EVLALTGPFS VVFWPCLLVW SWLTGRLPVN AKMLVVVGIG AFVQLAAVVL MGVNKYGVGI       240
     AAASAWVRAV KIFVGSFVTL SGVTGGVAVL AIFVLLAFGL RRNFVERLRG GYLPFGLVCM       300
     ALLTLLMGLW THKHMPDEIN PLGPGERYFF LPFNFLFMAV IASAQAVGKK YHWFCLVVAL       360
     SLVFGWSRHF RKGELSDFRW RDYYALSQVT QDSLIPIQPG WVLRLNNDRP DRLVSVMPVD       420
     LSRLEPFYGV LHTDGDETTL IEERVSGDPA SQIVFDVPSS CLKTEHRFVR VALKDAARVH       480
     LYLPDVNDIS SKSASLIWHV GANDHWYFDV PNRVSTKIVR LGVTSDSGGI VRGLKLSWVC       540
     W                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page