(data stored in ACNUC7421 zone)

EMBL: CP000270.PE73

CP000270.PE73        Location/Qualifiers
FT   CDS             complement(90110..90718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4389"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4389"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28611"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q146X8"
FT                   /protein_id="ABE28611.1"
FT                   /translation="MNQRALDYLALRPDFRAIARWVEPRATVLDLGCGDGSLLSLLSEE
FT                   LDVLGYGIEINDAGVLASTQNGVNVIQQNLEDGLRLFEDGSFDFAILSQTLQTIHQTAA
FT                   ILRETVRVGKECIVSFPNFGYWAHRLSVLRGRMPVSKSLPYQWHNTPNVRVLTIEDFEA
FT                   LAPEVGIEILDRVVLHEGQVVRWGVNWRGSLAVYRVKKS"
     MNQRALDYLA LRPDFRAIAR WVEPRATVLD LGCGDGSLLS LLSEELDVLG YGIEINDAGV        60
     LASTQNGVNV IQQNLEDGLR LFEDGSFDFA ILSQTLQTIH QTAAILRETV RVGKECIVSF       120
     PNFGYWAHRL SVLRGRMPVS KSLPYQWHNT PNVRVLTIED FEALAPEVGI EILDRVVLHE       180
     GQVVRWGVNW RGSLAVYRVK KS                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page