(data stored in ACNUC7421 zone)

EMBL: CP000270.PE77

CP000270.PE77        Location/Qualifiers
FT   CDS             complement(93865..94764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4385"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4385"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28615"
FT                   /db_xref="GOA:Q146X4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146X4"
FT                   /protein_id="ABE28615.1"
FT                   /translation="MSELPDLSQIAPTLKAEILAEALPYIRQYHGKTVVIKYGGNAMTE
FT                   ERLKQGFARDVILLKLVGINPVIVHGGGPQIDQALKKIGKQGTFIQGMRVTDEETMEVV
FT                   EWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLIHARKMLMPDRDNPGQYVDIGQVGEV
FT                   EAINPAVVKALQDDAFIPVISPIGFGEDGLSYNINADLVAGKLAVVLNAEKLVMMTNIP
FT                   GVMDKEGNLLTDLSAREIDGLFADGTISGGMLPKISSALDAAKSGVRSVHIIDGRIEHS
FT                   VLLEILTEQPFGTMIRSH"
     MSELPDLSQI APTLKAEILA EALPYIRQYH GKTVVIKYGG NAMTEERLKQ GFARDVILLK        60
     LVGINPVIVH GGGPQIDQAL KKIGKQGTFI QGMRVTDEET MEVVEWVLGG EVQQDIVTLI       120
     NHFGGHAVGL TGKDGGLIHA RKMLMPDRDN PGQYVDIGQV GEVEAINPAV VKALQDDAFI       180
     PVISPIGFGE DGLSYNINAD LVAGKLAVVL NAEKLVMMTN IPGVMDKEGN LLTDLSAREI       240
     DGLFADGTIS GGMLPKISSA LDAAKSGVRS VHIIDGRIEH SVLLEILTEQ PFGTMIRSH        299
//

If you have problems or comments...

PBIL Back to PBIL home page