(data stored in ACNUC7421 zone)

EMBL: CP000270.PE78

CP000270.PE78        Location/Qualifiers
FT   CDS             complement(95295..96935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4384"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4384"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28616"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q146X3"
FT                   /protein_id="ABE28616.1"
FT                   /translation="MLPTSSGEADASSAFLTVLREAAAARHDGTAQTEAGCLDAAARLH
FT                   PLDDASLASLTATLLEQHRLGDAIELAAIIAQLDPHRALAHFRHGYALQIANRHGEAIA
FT                   PYRRALAIDPRLPCLRSNLAGALAHVGGDLNEQIALLECAVRDEPGEGDGWTNLTNAYR
FT                   MNRDLPRALEAGVKAVQCAPHSPLAHNNYALTLREAQRWSEAERAAQTACALGPNDPAL
FT                   RSNLSMLQLIRADYEHGWASHEARWDGSAELGGNRPVMPAPLWRGEPLAGKTLLVWGEQ
FT                   GMGDVLQFCRYIPMLAGRVHREGGRLVWNSFPQMGALLARSLGAHADEFSAGGGVESLP
FT                   AFDYEIPLLSLPLIFDTREETIPAATAPYLHADPAAIRSWQKRLAGESRLKVGLTWTGS
FT                   HSHQRNPFRRVGWERYAAYFGGMQDVAFYSLQPGATDEVAAARAAGLSMTDCTAEFTSF
FT                   DDTAAFVGALDLVITVCTSAAHLSGALGQRTWVLLDVNPHWVWLLDRRDSPWYPGATLY
FT                   RQPRFGEWEPALAAVARDLKALAGERRAA"
     MLPTSSGEAD ASSAFLTVLR EAAAARHDGT AQTEAGCLDA AARLHPLDDA SLASLTATLL        60
     EQHRLGDAIE LAAIIAQLDP HRALAHFRHG YALQIANRHG EAIAPYRRAL AIDPRLPCLR       120
     SNLAGALAHV GGDLNEQIAL LECAVRDEPG EGDGWTNLTN AYRMNRDLPR ALEAGVKAVQ       180
     CAPHSPLAHN NYALTLREAQ RWSEAERAAQ TACALGPNDP ALRSNLSMLQ LIRADYEHGW       240
     ASHEARWDGS AELGGNRPVM PAPLWRGEPL AGKTLLVWGE QGMGDVLQFC RYIPMLAGRV       300
     HREGGRLVWN SFPQMGALLA RSLGAHADEF SAGGGVESLP AFDYEIPLLS LPLIFDTREE       360
     TIPAATAPYL HADPAAIRSW QKRLAGESRL KVGLTWTGSH SHQRNPFRRV GWERYAAYFG       420
     GMQDVAFYSL QPGATDEVAA ARAAGLSMTD CTAEFTSFDD TAAFVGALDL VITVCTSAAH       480
     LSGALGQRTW VLLDVNPHWV WLLDRRDSPW YPGATLYRQP RFGEWEPALA AVARDLKALA       540
     GERRAA                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page