(data stored in ACNUC7421 zone)

EMBL: CP000270.PE84

CP000270.PE84        Location/Qualifiers
FT   CDS             101909..102265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4378"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28622"
FT                   /db_xref="UniProtKB/TrEMBL:Q146W7"
FT                   /protein_id="ABE28622.1"
FT                   /translation="MLLRYCLPATGLFRLCQPALSAYCPDKIFRRRFRPGAGYALTGQF
FT                   VLILQWARIVTESQSGTATGENPPAARRYPENITRARPKSDGRARFNTAGFSRVFHTRA
FT                   FSTGFRPPPAIFSR"
     MLLRYCLPAT GLFRLCQPAL SAYCPDKIFR RRFRPGAGYA LTGQFVLILQ WARIVTESQS        60
     GTATGENPPA ARRYPENITR ARPKSDGRAR FNTAGFSRVF HTRAFSTGFR PPPAIFSR         118
//

If you have problems or comments...

PBIL Back to PBIL home page