(data stored in ACNUC7421 zone)

EMBL: CP000270.PE94

CP000270.PE94        Location/Qualifiers
FT   CDS             complement(111929..112135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4368"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28632"
FT                   /db_xref="GOA:Q146V7"
FT                   /db_xref="InterPro:IPR021521"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V7"
FT                   /protein_id="ABE28632.1"
FT                   /translation="MTKAISIALIVGGIVLLYFGGQAFNSVSSDVSRVFTGSPTNKAIL
FT                   LLVGGVAATIAGLTGMALSGRKR"
     MTKAISIALI VGGIVLLYFG GQAFNSVSSD VSRVFTGSPT NKAILLLVGG VAATIAGLTG        60
     MALSGRKR                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page