(data stored in ACNUC7421 zone)

EMBL: CP000270.PE96

CP000270.PE96        Location/Qualifiers
FT   CDS             complement(113457..113642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4366"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4366"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28634"
FT                   /db_xref="GOA:Q146V5"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V5"
FT                   /protein_id="ABE28634.1"
FT                   /translation="MTTYFTIGDFILVIPMALAGALFVGALPCKTEFRHNALRVLGALI
FT                   GVVFAVVLVEGLPALV"
     MTTYFTIGDF ILVIPMALAG ALFVGALPCK TEFRHNALRV LGALIGVVFA VVLVEGLPAL        60
     V                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page