(data stored in ACNUC7421 zone)

EMBL: CP000270.PE99

CP000270.PE99        Location/Qualifiers
FT   CDS             complement(116909..118312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4363"
FT                   /product="RND efflux pump, membrane fusion protein, CzcB
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4363"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28637"
FT                   /db_xref="GOA:Q146V2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V2"
FT                   /protein_id="ABE28637.1"
FT                   /translation="MEGQRPDSSGTTRDPAKTKRARWIAVAVAVAVIALAAQGIWSRHD
FT                   AHAALERDAEHASQTSVEVVRPQKSTAGLDLVLPGNVQAFLDTPIYARTNGYLKKWYAD
FT                   IGAKVKNGQLLAEIDTPEVDDQLRAARADLANAEANYALAKSTAARWTEMLKSKSVSKQ
FT                   ETDEKVGDMLAKKATLDAARFNVARLEKTQSFQKVYAPFDGIVTARNVDVGALIDAGSS
FT                   GGPAKELFHVAQADRLRVYVNVPQAYAQQVRARQTAFLTLTETPSRHYPGTVARTAGAV
FT                   DPQQRTMLVEVDVDNRNGDLLPGAYAQVHFELGTGAAPFTLPGNALLFRPDGVKLATVD
FT                   AQHKVKLIAVSLGTDFGTRVAIASGLQGDEQVILNPQDSIIDGAPVRIVAAKAGTATGA
FT                   SGATGASGSAAGGEGTAGASGAAASRDGAASASGAAAGNDRAAGGSNAVAADTPTTHVA
FT                   ASLSVKASS"
     MEGQRPDSSG TTRDPAKTKR ARWIAVAVAV AVIALAAQGI WSRHDAHAAL ERDAEHASQT        60
     SVEVVRPQKS TAGLDLVLPG NVQAFLDTPI YARTNGYLKK WYADIGAKVK NGQLLAEIDT       120
     PEVDDQLRAA RADLANAEAN YALAKSTAAR WTEMLKSKSV SKQETDEKVG DMLAKKATLD       180
     AARFNVARLE KTQSFQKVYA PFDGIVTARN VDVGALIDAG SSGGPAKELF HVAQADRLRV       240
     YVNVPQAYAQ QVRARQTAFL TLTETPSRHY PGTVARTAGA VDPQQRTMLV EVDVDNRNGD       300
     LLPGAYAQVH FELGTGAAPF TLPGNALLFR PDGVKLATVD AQHKVKLIAV SLGTDFGTRV       360
     AIASGLQGDE QVILNPQDSI IDGAPVRIVA AKAGTATGAS GATGASGSAA GGEGTAGASG       420
     AAASRDGAAS ASGAAAGNDR AAGGSNAVAA DTPTTHVAAS LSVKASS                     467
//

If you have problems or comments...

PBIL Back to PBIL home page