(data stored in ACNUC7421 zone)

EMBL: CP000271.FAE

CP000271.FAE         Location/Qualifiers
FT   CDS             complement(691827..692336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fae"
FT                   /locus_tag="Bxe_B2436"
FT                   /product="Formaldehyde-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2436"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33555"
FT                   /db_xref="GOA:Q13QT4"
FT                   /db_xref="InterPro:IPR014826"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR037075"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT4"
FT                   /protein_id="ABE33555.1"
FT                   /translation="MAKINRVLIGESLVGDGNEVAHIDLLIGPRGSAAETAFCNALTNN
FT                   KDGFTSLLAVIAPNLLTKPNTILFNKVTIKGAKQAVQMFGPAQHAVALAVADSVEDGTI
FT                   PKDEADDLFLCVGVFIHWQADDDKKIQEFNYKATREAIQRAVAGEPSAAEVVAKKGSVA
FT                   HPFAPN"
     MAKINRVLIG ESLVGDGNEV AHIDLLIGPR GSAAETAFCN ALTNNKDGFT SLLAVIAPNL        60
     LTKPNTILFN KVTIKGAKQA VQMFGPAQHA VALAVADSVE DGTIPKDEAD DLFLCVGVFI       120
     HWQADDDKKI QEFNYKATRE AIQRAVAGEP SAAEVVAKKG SVAHPFAPN                   169
//

If you have problems or comments...

PBIL Back to PBIL home page