(data stored in ACNUC7421 zone)

EMBL: CP000271.FHCA

CP000271.FHCA        Location/Qualifiers
FT   CDS             complement(664362..666062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhcA"
FT                   /locus_tag="Bxe_B2462"
FT                   /product="formylmethanofuran dehydrogenase, subunit A"
FT                   /EC_number="1.2.7.12"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2462"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33529"
FT                   /db_xref="GOA:Q13QW0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012027"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QW0"
FT                   /protein_id="ABE33529.1"
FT                   /translation="MSLIRLKGGTLFDPTHGVNGERRDLAIRDGRIVEVPAATPADHEY
FT                   DATGMIVMAGGIDMHSHIGGGKTNLSRLLLPEDHRDDRVRDAAYESVQDANGRYLRLPS
FT                   CGVCTPGTLATGYRYAEMGYTAAFEPAMMPSNARHTHLEMGDTPIIDHGAYVMLGNDEL
FT                   FLQMLAARDDFERLRDYIGWTIHASKALGVKVVNPGGISAFKFNQRSLNVDEPHVHYGI
FT                   TPREVLHTLSRALTELRVPHPLHVHASNLGVPGNIDSTIATMDAAGGLPIHLTHIQFHS
FT                   YGTEGPQKFSSGARQIAEAVNARPNVSIDVGQIIFGQTVTASGDTMMQFRNTPLARPHK
FT                   WVIGDIECDAGCGVVPFRYREQSYVNALQWIIGLEIFLLIDDPWRVAMTTDHPNGGPFT
FT                   SYPHLIRLLMDKSFRDEQLAKLNADAQVASALPQLQREFSLYEIAIITRAGPARLLGLR
FT                   DRGHLGVGAAADIAVYRDDADRERMFTSPAYVFKDGELVARDGTLVATPTGGIHFVSPD
FT                   FDRGIEKTLRAYSDANLANNFAHAAIGDDEICHCCRGGRLLPVECLSNG"
     MSLIRLKGGT LFDPTHGVNG ERRDLAIRDG RIVEVPAATP ADHEYDATGM IVMAGGIDMH        60
     SHIGGGKTNL SRLLLPEDHR DDRVRDAAYE SVQDANGRYL RLPSCGVCTP GTLATGYRYA       120
     EMGYTAAFEP AMMPSNARHT HLEMGDTPII DHGAYVMLGN DELFLQMLAA RDDFERLRDY       180
     IGWTIHASKA LGVKVVNPGG ISAFKFNQRS LNVDEPHVHY GITPREVLHT LSRALTELRV       240
     PHPLHVHASN LGVPGNIDST IATMDAAGGL PIHLTHIQFH SYGTEGPQKF SSGARQIAEA       300
     VNARPNVSID VGQIIFGQTV TASGDTMMQF RNTPLARPHK WVIGDIECDA GCGVVPFRYR       360
     EQSYVNALQW IIGLEIFLLI DDPWRVAMTT DHPNGGPFTS YPHLIRLLMD KSFRDEQLAK       420
     LNADAQVASA LPQLQREFSL YEIAIITRAG PARLLGLRDR GHLGVGAAAD IAVYRDDADR       480
     ERMFTSPAYV FKDGELVARD GTLVATPTGG IHFVSPDFDR GIEKTLRAYS DANLANNFAH       540
     AAIGDDEICH CCRGGRLLPV ECLSNG                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page