(data stored in ACNUC7421 zone)

EMBL: CP000271.FHCB

CP000271.FHCB        Location/Qualifiers
FT   CDS             complement(666059..667459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhcB"
FT                   /locus_tag="Bxe_B2461"
FT                   /product="formylmethanofuran dehydrogenase, subunit B"
FT                   /EC_number="1.2.7.12"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2461"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33530"
FT                   /db_xref="GOA:Q13QV9"
FT                   /db_xref="InterPro:IPR016457"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV9"
FT                   /protein_id="ABE33530.1"
FT                   /translation="MELAKSAAMHLSSIDPSSTSPSAANSAPASPVTRDWICPFCPLLC
FT                   DDLVVESREDATLAVPDTECPRLAQALACYGSADAQCGNSVDGHDADLDTALASAARIL
FT                   SSARRPLFGALTTDVAGTRALYTLAAGCGAILDHLHGDAMSAATLPLQDRGSFFTTLSE
FT                   VRSRADLLVFFGCRPSQRYPRFFARTLEGTQQQRELVFVGCAPDPAASGLANTRIEALL
FT                   PDADPFDTLALWSALSEGREPGALQDDGTGAAEALAELQARIAAAHYTVLVYEPAALPG
FT                   PHAALLIEALNRIVKAANRTVRAGCLALGGDDGALTVNQTVTWLSGLPLRTRVSTPARI
FT                   AGTAPLDYDPYRYRTARLLAEGEIDALLWVASFAPPAWPQALAEDVPAIVLGHPALAQA
FT                   AKSRGGATVFIPVATPGIDSGGHLFRVDGSVVLPLAAARGAALPSVAAIASQLAERLHA
FT                   QPAAQVQP"
     MELAKSAAMH LSSIDPSSTS PSAANSAPAS PVTRDWICPF CPLLCDDLVV ESREDATLAV        60
     PDTECPRLAQ ALACYGSADA QCGNSVDGHD ADLDTALASA ARILSSARRP LFGALTTDVA       120
     GTRALYTLAA GCGAILDHLH GDAMSAATLP LQDRGSFFTT LSEVRSRADL LVFFGCRPSQ       180
     RYPRFFARTL EGTQQQRELV FVGCAPDPAA SGLANTRIEA LLPDADPFDT LALWSALSEG       240
     REPGALQDDG TGAAEALAEL QARIAAAHYT VLVYEPAALP GPHAALLIEA LNRIVKAANR       300
     TVRAGCLALG GDDGALTVNQ TVTWLSGLPL RTRVSTPARI AGTAPLDYDP YRYRTARLLA       360
     EGEIDALLWV ASFAPPAWPQ ALAEDVPAIV LGHPALAQAA KSRGGATVFI PVATPGIDSG       420
     GHLFRVDGSV VLPLAAARGA ALPSVAAIAS QLAERLHAQP AAQVQP                      466
//

If you have problems or comments...

PBIL Back to PBIL home page