(data stored in ACNUC7421 zone)

EMBL: CP000271.FHCC

CP000271.FHCC        Location/Qualifiers
FT   CDS             complement(662540..663385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhcC"
FT                   /locus_tag="Bxe_B2464"
FT                   /product="formylmethanofuran dehydrogenase, subunit C"
FT                   /EC_number="1.2.7.12"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2464"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33527"
FT                   /db_xref="GOA:Q13QW2"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR017550"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QW2"
FT                   /protein_id="ABE33527.1"
FT                   /translation="MSQRTTLRVKTPPGFRVDASSLLPMPLAAMSVADIEGMVLPAGND
FT                   RCIVGDIFDVSRHEAADVPEAPHAGATLVVENAEPWLDRIGARMTDGHLVVHGSTGDYS
FT                   GFQMAGGRLHIEGDAGHFTACEMRGGRLTVTGHSGDFAAGALAGDMEGMTGGTLTIHGN
FT                   AGARLADRMRRGLVLVGGNAGDFAASRLVAGTVGIAGQLGAHYAYGMRRGTLLLAQQPA
FT                   HLPPTFTEGGRGFDVFWALLVRSLATEIAPFSQWRAASLPTRHAGDLAVDGRGEILVVS
FT                   "
     MSQRTTLRVK TPPGFRVDAS SLLPMPLAAM SVADIEGMVL PAGNDRCIVG DIFDVSRHEA        60
     ADVPEAPHAG ATLVVENAEP WLDRIGARMT DGHLVVHGST GDYSGFQMAG GRLHIEGDAG       120
     HFTACEMRGG RLTVTGHSGD FAAGALAGDM EGMTGGTLTI HGNAGARLAD RMRRGLVLVG       180
     GNAGDFAASR LVAGTVGIAG QLGAHYAYGM RRGTLLLAQQ PAHLPPTFTE GGRGFDVFWA       240
     LLVRSLATEI APFSQWRAAS LPTRHAGDLA VDGRGEILVV S                           281
//

If you have problems or comments...

PBIL Back to PBIL home page