(data stored in ACNUC7421 zone)

EMBL: CP000271.ORF19

CP000271.ORF19       Location/Qualifiers
FT   CDS             complement(672255..672854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf19"
FT                   /locus_tag="Bxe_B2455"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2455"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33536"
FT                   /db_xref="GOA:Q13QV3"
FT                   /db_xref="InterPro:IPR007386"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV3"
FT                   /protein_id="ABE33536.1"
FT                   /translation="MIHETIVTTAACDGRPHIAPMGARYEGDFVILSPFRPSVTLDNIV
FT                   ASRAAVLNFTTDVRIFAGCVTHCATDWPTLAASRVASVRLAESLAHAELELDDLRDDKE
FT                   RPVLRMKCVHRENHAPFGGFNRAQAAVVEGAILVSRLFMLPADKVDREMAYLQIAIDKT
FT                   AGEAELTAWHWLTAAIARHRENLAASGGPAAELVSH"
     MIHETIVTTA ACDGRPHIAP MGARYEGDFV ILSPFRPSVT LDNIVASRAA VLNFTTDVRI        60
     FAGCVTHCAT DWPTLAASRV ASVRLAESLA HAELELDDLR DDKERPVLRM KCVHRENHAP       120
     FGGFNRAQAA VVEGAILVSR LFMLPADKVD REMAYLQIAI DKTAGEAELT AWHWLTAAIA       180
     RHRENLAASG GPAAELVSH                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page