(data stored in ACNUC7421 zone)

EMBL: CP000271.ORF22

CP000271.ORF22       Location/Qualifiers
FT   CDS             complement(671485..672228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf22"
FT                   /locus_tag="Bxe_B2456"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2456"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33535"
FT                   /db_xref="GOA:Q13QV4"
FT                   /db_xref="InterPro:IPR007565"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV4"
FT                   /protein_id="ABE33535.1"
FT                   /translation="MTALLASVRSDEEAFDAAQAGAELIDLKEPNAGALGGLSIGDITQ
FT                   IARRLRAHYPVKPISATIGDVPADALDEITTRVIEVSDAGIDYVKVGVTPGPAARRCLE
FT                   QLANLPAAVVPVLLCDGGMDGELVAYAATLDFVGVMFDTAGKDGSTLFDHVDSDTLAQW
FT                   LRITRERGAMSGIAGSLGWAQFEQIRALAPDVAGFRTALCVDGRRSRLDPQRVAQWAAA
FT                   LHRPSGEVSGAVAAADTRASGTARF"
     MTALLASVRS DEEAFDAAQA GAELIDLKEP NAGALGGLSI GDITQIARRL RAHYPVKPIS        60
     ATIGDVPADA LDEITTRVIE VSDAGIDYVK VGVTPGPAAR RCLEQLANLP AAVVPVLLCD       120
     GGMDGELVAY AATLDFVGVM FDTAGKDGST LFDHVDSDTL AQWLRITRER GAMSGIAGSL       180
     GWAQFEQIRA LAPDVAGFRT ALCVDGRRSR LDPQRVAQWA AALHRPSGEV SGAVAAADTR       240
     ASGTARF                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page