(data stored in ACNUC7421 zone)

EMBL: CP000271.ORF5

CP000271.ORF5        Location/Qualifiers
FT   CDS             complement(693369..694403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf5"
FT                   /locus_tag="Bxe_B2434"
FT                   /product="SSU ribosomal protein S6P modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2434"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33557"
FT                   /db_xref="GOA:Q13QT2"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT2"
FT                   /protein_id="ABE33557.1"
FT                   /translation="MSFPVPGAEPADSRATLRIAIMTDETGWHTGRLKKAFRARGAQAR
FT                   CIDLADCRIDTTWEPHGLVLPGFGHTLPDAVFVRGIAGGTFEQVTLRLGILHALRESGV
FT                   PVYNDARAIERSVDKSMTSFLLHRNGVPTPATWAGESAAFAQRVLMREAAAGRQVVLKP
FT                   LFGSQGHGLKRLGAGGAHPGALAPLPSLKAYRQVAYLQRYIEGGRPGFDWRVLVIGGRA
FT                   VAAMRRVGGKGWIHNFAQGAACEAAELDLPLAQTAVRATEALGLDYAGVDLIPDPRDAA
FT                   RPLVLEVNGVAAWRGLQSVTSIDIAAALADDLLLRKLPAQRRALSESAETREAAVVALH
FT                   GRHG"
     MSFPVPGAEP ADSRATLRIA IMTDETGWHT GRLKKAFRAR GAQARCIDLA DCRIDTTWEP        60
     HGLVLPGFGH TLPDAVFVRG IAGGTFEQVT LRLGILHALR ESGVPVYNDA RAIERSVDKS       120
     MTSFLLHRNG VPTPATWAGE SAAFAQRVLM REAAAGRQVV LKPLFGSQGH GLKRLGAGGA       180
     HPGALAPLPS LKAYRQVAYL QRYIEGGRPG FDWRVLVIGG RAVAAMRRVG GKGWIHNFAQ       240
     GAACEAAELD LPLAQTAVRA TEALGLDYAG VDLIPDPRDA ARPLVLEVNG VAAWRGLQSV       300
     TSIDIAAALA DDLLLRKLPA QRRALSESAE TREAAVVALH GRHG                        344
//

If you have problems or comments...

PBIL Back to PBIL home page