(data stored in ACNUC7421 zone)

EMBL: CP000271.ORFY

CP000271.ORFY        Location/Qualifiers
FT   CDS             complement(695406..696614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orfY"
FT                   /locus_tag="Bxe_B2432"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Required for methylotrophy"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2432"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33559"
FT                   /db_xref="GOA:Q13QT0"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016677"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT0"
FT                   /protein_id="ABE33559.1"
FT                   /translation="MKPRPSLPSAPFVAVAGLSARMLAQSAARAGLRVAALDVFGDRDT
FT                   REASELWFDIGGGPLSIDAERLVAALERTARLPGLIGWIDGSGLEPFVARLCGMPRLPR
FT                   FIGNPVEASAAVREPRRFFALLDALEIAHPPVVFAPPAVAHGWLVKRADGCGGTHIEPA
FT                   AAFGDPRIPAQIYFQRRRGGRSLSALFIAAFGHARVLGFAEQLTCEMGNLPFVHAGSIG
FT                   PIDLPLTVQARVHAAIAALCAQTRLTGINSCDFLLDGDAFELLEINTRPSSTMTLYETA
FT                   SPHAWPRGLLACHIEACRLGRLPAAPTPAAAPWRAGQQVLFAPHPFTVSQSFSDACLHD
FT                   PRCRDVPMPGTRIETGQPVCTLLVRAASVDAVRYALDAQRAFVLQRIDTCHEPDYAFIQ
FT                   CHS"
     MKPRPSLPSA PFVAVAGLSA RMLAQSAARA GLRVAALDVF GDRDTREASE LWFDIGGGPL        60
     SIDAERLVAA LERTARLPGL IGWIDGSGLE PFVARLCGMP RLPRFIGNPV EASAAVREPR       120
     RFFALLDALE IAHPPVVFAP PAVAHGWLVK RADGCGGTHI EPAAAFGDPR IPAQIYFQRR       180
     RGGRSLSALF IAAFGHARVL GFAEQLTCEM GNLPFVHAGS IGPIDLPLTV QARVHAAIAA       240
     LCAQTRLTGI NSCDFLLDGD AFELLEINTR PSSTMTLYET ASPHAWPRGL LACHIEACRL       300
     GRLPAAPTPA AAPWRAGQQV LFAPHPFTVS QSFSDACLHD PRCRDVPMPG TRIETGQPVC       360
     TLLVRAASVD AVRYALDAQR AFVLQRIDTC HEPDYAFIQC HS                          402
//

If you have problems or comments...

PBIL Back to PBIL home page