(data stored in ACNUC7421 zone)

EMBL: CP000271.PE10

CP000271.PE10        Location/Qualifiers
FT   CDS             complement(11713..12363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3019"
FT                   /product="putative YceI like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3019"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32978"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG1"
FT                   /protein_id="ABE32978.1"
FT                   /translation="MSTLTLRATFVRAFLSAMLLTAAACTPLQVLTHSVSQNEARVPPG
FT                   RYEIDPDHCSITFDIDHFKYSRFTARFDRKKGELDWNEGGLDRSTTSVTIDAASIDTNV
FT                   PLLDKMVKSGSMLDVERYPEIRFVSTRFERTGESRGTLTGDLTIHGVTQPVTLDVTFNG
FT                   FAPDPLTKKDTLGFSAEGRFSRARFGLATWYPAVGDDIHVRIQAEFVKTPAGG"
     MSTLTLRATF VRAFLSAMLL TAAACTPLQV LTHSVSQNEA RVPPGRYEID PDHCSITFDI        60
     DHFKYSRFTA RFDRKKGELD WNEGGLDRST TSVTIDAASI DTNVPLLDKM VKSGSMLDVE       120
     RYPEIRFVST RFERTGESRG TLTGDLTIHG VTQPVTLDVT FNGFAPDPLT KKDTLGFSAE       180
     GRFSRARFGL ATWYPAVGDD IHVRIQAEFV KTPAGG                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page