(data stored in SCRATCH zone)

EMBL: CP000271.PE100

CP000271.PE100       Location/Qualifiers
FT   CDS             115183..115569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2927"
FT                   /product="Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2927"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33068"
FT                   /db_xref="GOA:Q13S71"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S71"
FT                   /protein_id="ABE33068.1"
FT                   /translation="MKPVGATKQAGFAGDPHLLQQKALELAGGDHVTARRLLEMIAQTD
FT                   RTALAALRDSFRTASWDGVGSAAHRIAGSARMLECHEVFALLTRLEAAARGRDIVLATA
FT                   LLPHVADALGELGASIGKALTSTD"
     MKPVGATKQA GFAGDPHLLQ QKALELAGGD HVTARRLLEM IAQTDRTALA ALRDSFRTAS        60
     WDGVGSAAHR IAGSARMLEC HEVFALLTRL EAAARGRDIV LATALLPHVA DALGELGASI       120
     GKALTSTD                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page