(data stored in SCRATCH zone)

EMBL: CP000271.PE102

CP000271.PE102       Location/Qualifiers
FT   CDS             complement(116441..117277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2925"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33070"
FT                   /db_xref="GOA:Q13S69"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S69"
FT                   /protein_id="ABE33070.1"
FT                   /translation="MNPPDLKLQQIPSRRTRLTGNARRTSQSGQSMTEFIIIAPVLLFV
FT                   CFGILQFVLLYQAKSTLDVAALEAAREGAVNHGSMQSMRNGLARGLAPLYAHQANAEGV
FT                   AAALASAQTDAARFSSITVLNPTPAAIQDYSRPRYYADQAATYSEIPNDSLMYRDSSVP
FT                   PGAMSRMNIQDANLLKIHVHYCYDMYVPLVNKVIYYAANVIGAIGTGGILTREPANVTQ
FT                   DPYGDPKNGDYLCKVKLADGIATGHWPISLDSEAMVRMQSPLRASALNDSPNPTGN"
     MNPPDLKLQQ IPSRRTRLTG NARRTSQSGQ SMTEFIIIAP VLLFVCFGIL QFVLLYQAKS        60
     TLDVAALEAA REGAVNHGSM QSMRNGLARG LAPLYAHQAN AEGVAAALAS AQTDAARFSS       120
     ITVLNPTPAA IQDYSRPRYY ADQAATYSEI PNDSLMYRDS SVPPGAMSRM NIQDANLLKI       180
     HVHYCYDMYV PLVNKVIYYA ANVIGAIGTG GILTREPANV TQDPYGDPKN GDYLCKVKLA       240
     DGIATGHWPI SLDSEAMVRM QSPLRASALN DSPNPTGN                               278
//

If you have problems or comments...

PBIL Back to PBIL home page