(data stored in SCRATCH zone)

EMBL: CP000271.PE103

CP000271.PE103       Location/Qualifiers
FT   CDS             complement(117274..117624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2924"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2924"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33071"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S68"
FT                   /protein_id="ABE33071.1"
FT                   /translation="MKRARLHVRGHDIGVEVSITETARECMRGLLGRAALASGEALLLD
FT                   RCGSVHTFGMRFAIDVLFLDRRQRVVAIHHDVPRRRMLFSLRATHTLEMPAHSARRHGL
FT                   AVGDSLVFEATS"
     MKRARLHVRG HDIGVEVSIT ETARECMRGL LGRAALASGE ALLLDRCGSV HTFGMRFAID        60
     VLFLDRRQRV VAIHHDVPRR RMLFSLRATH TLEMPAHSAR RHGLAVGDSL VFEATS           116
//

If you have problems or comments...

PBIL Back to PBIL home page