(data stored in SCRATCH zone)

EMBL: CP000271.PE104

CP000271.PE104       Location/Qualifiers
FT   CDS             complement(117621..118502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2923"
FT                   /product="Putative type II secretion system protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2923"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33072"
FT                   /db_xref="GOA:Q13S67"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S67"
FT                   /protein_id="ABE33072.1"
FT                   /translation="MLLFIAFLVSFGLIAFIAVGYRSLNGLAGAVPEEDRLFLDPLPKS
FT                   LRPLWPLVNFVVHHFGNSFSAKLVEKTDLQLRLTSLTFLMNARQFIALSIIASILASLV
FT                   TLLLMLALGMFSVLILILVAALGYFYPRIWTRDVRRRRVAQILRHLPIYLDFLTLAVEA
FT                   GLNINGAIQKAVEKGPEGPLRRELEHVLRDLKSGLNRTEALRRLDDRLRIKEVTNLVGT
FT                   VVQAERMGSGLAKSLRFQSEQRRSERFQRAEKQAMEAPVKLVFPLLFFIFPITFIVLGF
FT                   PIAMKFVQEGLL"
     MLLFIAFLVS FGLIAFIAVG YRSLNGLAGA VPEEDRLFLD PLPKSLRPLW PLVNFVVHHF        60
     GNSFSAKLVE KTDLQLRLTS LTFLMNARQF IALSIIASIL ASLVTLLLML ALGMFSVLIL       120
     ILVAALGYFY PRIWTRDVRR RRVAQILRHL PIYLDFLTLA VEAGLNINGA IQKAVEKGPE       180
     GPLRRELEHV LRDLKSGLNR TEALRRLDDR LRIKEVTNLV GTVVQAERMG SGLAKSLRFQ       240
     SEQRRSERFQ RAEKQAMEAP VKLVFPLLFF IFPITFIVLG FPIAMKFVQE GLL              293
//

If you have problems or comments...

PBIL Back to PBIL home page