(data stored in SCRATCH zone)

EMBL: CP000271.PE105

CP000271.PE105       Location/Qualifiers
FT   CDS             complement(118506..119354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2922"
FT                   /product="Putative type II secretion system protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2922"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33073"
FT                   /db_xref="GOA:Q13S66"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S66"
FT                   /protein_id="ABE33073.1"
FT                   /translation="MSLPLILALAFFGSLFLIFLLSRMGTSTLRAGSRQMAGEIESSLA
FT                   DAFVFVNRQKAAAWSMVVMVGLPVIVFLFSHSILFALASVPIAMMLPKKYLKRMRKKRI
FT                   EALEKQLPDALLMMSGALRAGASFPAALEAVVYETAPPISQEFDLLMREIRLGIDLDIA
FT                   MRNVEKRIPIPDLLMMTAAVTIAREVGGNLAEALESVARTLREKLQMEGKIRALTSQGR
FT                   MQGIVMTCLPLFLMLVLRFMEAKAMAPLFSEPVGWATLAVIGVMECLGYFWISRITNID
FT                   V"
     MSLPLILALA FFGSLFLIFL LSRMGTSTLR AGSRQMAGEI ESSLADAFVF VNRQKAAAWS        60
     MVVMVGLPVI VFLFSHSILF ALASVPIAMM LPKKYLKRMR KKRIEALEKQ LPDALLMMSG       120
     ALRAGASFPA ALEAVVYETA PPISQEFDLL MREIRLGIDL DIAMRNVEKR IPIPDLLMMT       180
     AAVTIAREVG GNLAEALESV ARTLREKLQM EGKIRALTSQ GRMQGIVMTC LPLFLMLVLR       240
     FMEAKAMAPL FSEPVGWATL AVIGVMECLG YFWISRITNI DV                          282
//

If you have problems or comments...

PBIL Back to PBIL home page