(data stored in ACNUC7421 zone)

EMBL: CP000271.PE106

CP000271.PE106       Location/Qualifiers
FT   CDS             complement(119367..121283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2921"
FT                   /product="type II/IV secretion system protein E"
FT                   /note="Putative type II/IV secretion system-relatedprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2921"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33074"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S65"
FT                   /protein_id="ABE33074.1"
FT                   /translation="MLNLQVHARNAPVRTLQVEQGCTIGKDASCDVIVKGLLIGKLQAR
FT                   IVREHNAYYIEDQGGIAATLVNGTAITRYGPLTEADQIEVGVTTIRIVRAAVAAQPQPQ
FT                   DAQHGQQAAQPSSETAHAGHAATPVARPLQAPASAHIEPSFAVAAQVQPMPEPFHPPAV
FT                   ERNAAPAGHYAPARHESIAMPTQRAAEVPPRTPPPQVKKTAAAPLPVAPINSPLGIELR
FT                   KQAHMKVIAALDLRRLNVARMEEDELRKTVSAALDDILNHDASFHTADIPLSALKKSVF
FT                   DEIIGLGPLEELIADPTVSEIMVNCHNEIFIEQNGQLTRSPVIFTDDRAVLGAIERIVA
FT                   PIGRRIDESSPMVDARLSDGSRVNAVIPPLALKGPSITIRKFSRQKLGGEDLIRFGSMS
FT                   PDMLEFLHTAVKEGANIVISGGTGSGKTTLLNVLSSYIPDDERIVTVEDAAELQLSQPN
FT                   LVSLEARPANMEGKGAIHIRDLVKNCLRMRPDRIVIGECRGGEALDMLQAMNTGHDGSL
FT                   TTAHANTPRDCIARLEVMTLMAGLDLPVQAIREQICSAVDLIVQQSRFSCGSRRVTHVT
FT                   EVSGMESGVITLQDVFVFKEEGFSEHGKIQGKFVPTAYVPDFYQELIRRRIPVNTDIFT
FT                   RIE"
     MLNLQVHARN APVRTLQVEQ GCTIGKDASC DVIVKGLLIG KLQARIVREH NAYYIEDQGG        60
     IAATLVNGTA ITRYGPLTEA DQIEVGVTTI RIVRAAVAAQ PQPQDAQHGQ QAAQPSSETA       120
     HAGHAATPVA RPLQAPASAH IEPSFAVAAQ VQPMPEPFHP PAVERNAAPA GHYAPARHES       180
     IAMPTQRAAE VPPRTPPPQV KKTAAAPLPV APINSPLGIE LRKQAHMKVI AALDLRRLNV       240
     ARMEEDELRK TVSAALDDIL NHDASFHTAD IPLSALKKSV FDEIIGLGPL EELIADPTVS       300
     EIMVNCHNEI FIEQNGQLTR SPVIFTDDRA VLGAIERIVA PIGRRIDESS PMVDARLSDG       360
     SRVNAVIPPL ALKGPSITIR KFSRQKLGGE DLIRFGSMSP DMLEFLHTAV KEGANIVISG       420
     GTGSGKTTLL NVLSSYIPDD ERIVTVEDAA ELQLSQPNLV SLEARPANME GKGAIHIRDL       480
     VKNCLRMRPD RIVIGECRGG EALDMLQAMN TGHDGSLTTA HANTPRDCIA RLEVMTLMAG       540
     LDLPVQAIRE QICSAVDLIV QQSRFSCGSR RVTHVTEVSG MESGVITLQD VFVFKEEGFS       600
     EHGKIQGKFV PTAYVPDFYQ ELIRRRIPVN TDIFTRIE                               638
//

If you have problems or comments...

PBIL Back to PBIL home page