(data stored in ACNUC7421 zone)

EMBL: CP000271.PE107

CP000271.PE107       Location/Qualifiers
FT   CDS             complement(121307..123094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2920"
FT                   /product="Putative type II and III secretion system
FT                   outermembrane protein, secretin"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2920"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33075"
FT                   /db_xref="GOA:Q13S64"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S64"
FT                   /protein_id="ABE33075.1"
FT                   /translation="MKVKNNAAPLRRRVLPSVLVGMLLCEAAPAALAQTAQAAHAAYTA
FT                   ATDSPSASTRVLEMFRGEVRILHIPGTIKRIAIGNGKLLTANVVDGSLMLLGEQDGITS
FT                   LVVWNDKGIALQTTVRIAKAEVNASLEQLRAVLRSVAGLRIDAIGSNIVLSGVIHRDMA
FT                   GTVKAATQEMKNVVDTTTFDEGDALRKTVHFKVQIMEVTRTGQRNLGIAWDSAFRGPQI
FT                   GGAASVATGAAKAITAGTSYFLAGIASNITSQINFAVENGDAYVLAAPELNTKSGGTAS
FT                   FLAGGQVPIPQSGALGTTSIEYKDYGIKLSIVPVVDANNIISAHLTTEISQIDPSVTYA
FT                   GMPGFLTRNTSSDISMRAGETLAISGLVSADAANDSNGMPFLSQVPIIGQLFRSDRFRA
FT                   KKSDLVIFVTPVISDPELSPNTDLLARADKLDENFRKEYGNTDPLVADEDKAKHVTTPR
FT                   QPIVPTPALLPTPVRSTPQVPAEPQASAPVVAGAEGPATPLAASVQTPAYVPAQIPAQA
FT                   AAPVSAQAPAQTQAAGAPAQLPPSPPPASTPPAGVAEALRMLNDPQHAQAMPAHDPMQP
FT                   ASNGKVPQQQIGVLGTSNN"
     MKVKNNAAPL RRRVLPSVLV GMLLCEAAPA ALAQTAQAAH AAYTAATDSP SASTRVLEMF        60
     RGEVRILHIP GTIKRIAIGN GKLLTANVVD GSLMLLGEQD GITSLVVWND KGIALQTTVR       120
     IAKAEVNASL EQLRAVLRSV AGLRIDAIGS NIVLSGVIHR DMAGTVKAAT QEMKNVVDTT       180
     TFDEGDALRK TVHFKVQIME VTRTGQRNLG IAWDSAFRGP QIGGAASVAT GAAKAITAGT       240
     SYFLAGIASN ITSQINFAVE NGDAYVLAAP ELNTKSGGTA SFLAGGQVPI PQSGALGTTS       300
     IEYKDYGIKL SIVPVVDANN IISAHLTTEI SQIDPSVTYA GMPGFLTRNT SSDISMRAGE       360
     TLAISGLVSA DAANDSNGMP FLSQVPIIGQ LFRSDRFRAK KSDLVIFVTP VISDPELSPN       420
     TDLLARADKL DENFRKEYGN TDPLVADEDK AKHVTTPRQP IVPTPALLPT PVRSTPQVPA       480
     EPQASAPVVA GAEGPATPLA ASVQTPAYVP AQIPAQAAAP VSAQAPAQTQ AAGAPAQLPP       540
     SPPPASTPPA GVAEALRMLN DPQHAQAMPA HDPMQPASNG KVPQQQIGVL GTSNN            595
//

If you have problems or comments...

PBIL Back to PBIL home page